DPCstruct | MC55416
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 68 ± 4 aa |
| Standard deviation of domain lengths | 4.30 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 65.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X2K703 | 1-74 | MSEVIQAQVLDPYTLPLYQRRLIEASAGTGKTYTIGLLYLRLLLGLGGESAFHRPLSVEEILVVTFTEAATDEL |
| A0A7C1L344 | 1-67 | MQALNPLTMPLTGQSLIEASAGTGKTYTITGLYLRYLLGMQIEGELNTPLSVEQILVVTFTDAATQE |
| A0A381GCJ4 | 5-71 | None |
| A0A485JAP2 | 100-170 | None |
| A0A1B8P6G2 | 4-74 | None |
| A0A448QPS3 | 1-62 | None |
| A0A259RYS5 | 1-63 | None |
| A0A485A0Q7 | 1-72 | None |
| A0A509MIW4 | 1-72 | None |
| A0A4U9IGX0 | 3-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.