DPCstruct | MC55405
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 266 ± 40 aa |
| Standard deviation of domain lengths | 39.95 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 20.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z1R8E8 | 77-388 | RKESKEVKEAKAPTPKRKRGNLTLGEQAVFQPVSNFSSSGYFPSGTQLQKRPQRKYSRSSAERVEQVLGQISIQTYFLVKKQEPPTE… |
| A0A810N5L8 | 92-294 | RSYGSDREGQALRWISTLVFKYLNHLALNPVEVQAAVHKGVLYVAANSGKSNTELARIAGRYKTGTQFVTRILDELDRFERAADSAL… |
| A0A1X2C9A0 | 417-624 | None |
| A0A5Q0GYV1 | 145-366 | None |
| A0A4U1JJX3 | 142-423 | None |
| A0A1Q9LJN9 | 103-384 | None |
| A0A1H5VQ48 | 250-506 | None |
| A0A2M8M5M4 | 1-226 | None |
| A0A0G4K0P1 | 460-747 | None |
| A0A7X4YFA9 | 34-328 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.