DPCstruct | MC5540
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 100 ± 11 aa |
| Standard deviation of domain lengths | 11.38 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 71.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.69 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 46.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09791 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2G5R8 | 11-91 | PFLVKLKARRLAPSRLADLYAAAGAKTPPPAPDPWECCGSSCKPCVKELWREELKCWNEIHPDGAEEEEEEEDEDRGEGKD |
| S7Z9U7 | 80-191 | TRENHPPHHLVDTHPHAHTHIEAYYTPSETPIFKRLQKTRLSGTRTKQLLRAASRAYNDPPPPPELGMCCGSSCDPCVNELWKEERD… |
| A0A5N5NG56 | 10-107 | None |
| A0A5M3Z191 | 10-115 | None |
| A0A5N6KVW9 | 3-104 | None |
| A0A074Y7Y7 | 1-101 | None |
| A0A505HXU6 | 1-101 | None |
| A0A7G5K0Q8 | 71-198 | None |
| A0A4S8MY89 | 1-97 | None |
| A0A177VP52 | 2-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.