DPCstruct | MC554
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 279 ± 32 aa |
| Standard deviation of domain lengths | 32.35 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A561GYF8 | 96-433 | RVQAMVAEFGAKSYTDASGASQAVTPDMLNNLQGTLNNSPVLAEEIKRAATTTDPLQPSHRILESFAFTAPGAGVRGSFNAPGHAMN… |
| A0A7W8JNK9 | 6-299 | KLDAMLTDFEKRTATDPNHPGQNLRNLLNHSPDLKARFLDSAGHDHLRRFDVLPANAHAGGTYNPDTKSMELPQSYLDSSRTSKSAR… |
| A0A845HHG6 | 1-225 | None |
| A0A1H7X536 | 27-357 | None |
| A0A7J5C174 | 1-303 | None |
| A0A2T5LFV9 | 100-403 | None |
| U2G4R4 | 31-263 | None |
| A0A6V7F920 | 1-255 | None |
| A0A0S2FAZ5 | 28-289 | None |
| A0A7W5EQX5 | 100-381 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.