DPCstruct | MC55393
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 76 ± 17 aa |
| Standard deviation of domain lengths | 16.80 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 88.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 49.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3CPM7 | 33-97 | MAQMENTDVFICTSPIKHYKHCPYEKYAWVEKHLGHEFLEQVILTRDKTLITGDILIDDKPDIQG |
| M7B7H0 | 33-100 | MAKLENTDVFICTSPIKKYRYCAYEKYAWVEKHFGQEFLEQIVLTRDKTVISGDLLIDDRSDITGAEP |
| A0A7S0IZ38 | 14-74 | None |
| A0A1E5KES6 | 17-77 | None |
| S9YX95 | 113-178 | None |
| A0A7J6QTC1 | 28-130 | None |
| A0A6J3H9E6 | 44-125 | None |
| A0A5A8DUV8 | 863-958 | None |
| A0A2D5VJT5 | 248-327 | None |
| C5LDZ5 | 60-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.