DPCstruct | MC55392
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 128 ± 9 aa |
| Standard deviation of domain lengths | 8.59 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 76.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 43.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10155 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3CLL4 | 1-126 | MRCDRFCEDELAWLNPTEPDHSVMWDRSMCVKNSTGVEIKRIMSKAFKSPLLAQQQSQLLAELEKDPRLVYHIGLTPAKLPDLVENN… |
| A0A7S3LRX9 | 1-120 | MKTGANDVVWLNPSDAPGLMWDVTMCEDSSRGAEVRELMTKAFKGPLVAVQQKHVLQELEADPKLVYHCGLTPQRLPDLVENNPVIA… |
| A0A1S8VDE4 | 116-246 | None |
| X6P788 | 1-111 | None |
| A0A182IY47 | 223-343 | None |
| A0A7I4CLW1 | 128-265 | None |
| T1KZP7 | 28-163 | None |
| A0A164X4F3 | 109-245 | None |
| A0A182FHF5 | 687-827 | None |
| A0A5J5CDD0 | 189-328 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.