DPCstruct | MC55390
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 75 ± 10 aa |
| Standard deviation of domain lengths | 10.05 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 53.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R6RTF9 | 7-85 | PISMREALTLPSIGINPQFITFTHVMVESDKYICVLETSPQNSVVIIDINMPMQPLRRPITADSALMNPNSKILALKAQ |
| H3CHT4 | 2-69 | QNLGINPANIGFSTLTMESDKFICIREKVGEQTQVVIIDMADPNTPIRRPISADSAIMNPASKVIALK |
| A0A813SQ29 | 13-84 | None |
| A0A1B7N2Q7 | 115-193 | None |
| A0A816PAP2 | 15-86 | None |
| A0A835LKW6 | 113-182 | None |
| Q10161 | 10-84 | None |
| A0A0V0ZK18 | 5-88 | None |
| A0A4X3P543 | 8-79 | None |
| A0A426YPA9 | 39-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.