DPCstruct | MC5539
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 174 ± 43 aa |
| Standard deviation of domain lengths | 42.75 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 87.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B0S4A0 | 62-234 | EFDYDQMWEIRLGLEKGLDVSVYAKLMFNDQQIHEIRLGLENNVDVSLYAKSEFDYDQMLEIRQGLESGVDVSVYAKPEFGSSQMEE… |
| A0A544QX60 | 15-160 | YNRDQLYQLNLGLEDGIDVSLYDDPRYKYDRMYEIRMGIMNGVDVSYYTNHLFDNNQMYQIRLGLEAGYDVSVYASDKFIWSQMEQI… |
| A0A317RDF3 | 20-144 | None |
| A0A1B3SLS1 | 210-393 | None |
| Q3EYX8 | 8-284 | None |
| A0A2U1CC04 | 7-104 | None |
| A0A431IX88 | 7-166 | None |
| A0A352T8F9 | 24-265 | None |
| A0A6N3F1M9 | 62-197 | None |
| A0A1I0CNF2 | 3-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.