DPCstruct | MC55389
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 115 ± 15 aa |
| Standard deviation of domain lengths | 15.42 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.72 |
| Pfam Score | 98.44 |
| Assigned Pfam label(s) | CL0063- CL0381 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4TFM4 | 5-111 | NSKFDVHVAEMSVLKKSATMPADSTIIKGYDFNEGINYDALLDQYMSTGFQASHFAQAVRRINTMLTIREEQFEGDHTLPYPEGKQK… |
| H3CCA9 | 5-117 | PPAVATEAVLKPSCDLPEDLPKIRGYDFNQGVDFQAVLKSYLTTGFQASRLGLAIQEINHMIEKRLEPVEVAEGNPWQKSGEAKPGC… |
| A0A251STC2 | 2-80 | None |
| R7QGB8 | 7-114 | None |
| A0A497EWT7 | 1-79 | None |
| A0A812TRX2 | 415-537 | None |
| B7XK19 | 7-104 | None |
| A0A835N9P5 | 809-928 | None |
| A0A0M9AN54 | 2-99 | None |
| A0A0D3AHX5 | 39-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.