DPCstruct | MC55380
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 78 ± 2 aa |
| Standard deviation of domain lengths | 1.84 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 87.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 73.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453CAB3 | 1-80 | EEIFASSFAAAAYLQSIDFPKDKKVYVIGEEGILKELELAGFQYLGGPTDGDKKIELKPGFYMEHDKDVSMIIVHLLILS |
| A0A059D1J2 | 81-157 | LSVTEEEIFASSFAAAAYLKSINFPKDKKVYVIGEDGILKELELAGIQYLGGPEDGGKKIELKPGFYMEHDEDVGAV |
| A0A811MQD6 | 48-124 | None |
| A0A059C9C9 | 138-214 | None |
| A0A445FWJ0 | 143-221 | None |
| A0A835LAU2 | 320-396 | None |
| A0A834SJD5 | 150-226 | None |
| C7J9I3 | 102-180 | None |
| A0A0E0FQ20 | 83-158 | None |
| A0A0E0IH24 | 80-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.