DPCstruct | MC55377
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 73 ± 6 aa |
| Standard deviation of domain lengths | 5.78 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 69.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01988 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453C5D4 | 35-108 | PPLCHVGRYLAAQSEADHYKREMKREQDEIIAVPDTEAAEIGDIMAEYGLEPHEYGPVVEGLRRNPQAWLEFMM |
| A0A1Y2CRT7 | 171-236 | YLSSKSEMDHWTAEEAREWAEVVRVPEVEEQEVVDVFEGYGMGRSELGPLLKRFREDPAVWVQFMM |
| A0A453C5E8 | 6-84 | None |
| A0A453KSC7 | 1-74 | None |
| A0A6A6LYP5 | 88-157 | None |
| A0A6N2M248 | 523-591 | None |
| A0A7I8J3V3 | 25-90 | None |
| A0A446U9E1 | 70-152 | None |
| A0A4D9AQ88 | 2-67 | None |
| A0A0D2V9M7 | 77-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.