DPCstruct | MC5537
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 91 ± 6 aa |
| Standard deviation of domain lengths | 5.79 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A167B2X9 | 1-94 | MDVVMYMTGALETFEKMDKQQLATTVFEIAKLGESGLSINDPAKRYTLKSLSGDFSGLQLLSMMHVGLKQIDPSIDSQSGLDAEYDA… |
| A0A1F9LP62 | 53-144 | ASFYCLDALRRFDGKGRAEIFIVASEIGILGMNGIDHITPSKTYPLKAYPGETFTGLHLLCLMYVGFKLYDPSMNCGLDFAEAYEIA… |
| A0A5E4IFE5 | 33-125 | None |
| A0A2M7PH14 | 1-101 | None |
| A0A1F4QJN4 | 28-119 | None |
| A0A3B9LVT8 | 321-412 | None |
| A0A354P9H1 | 67-146 | None |
| A0A7T1HXQ4 | 1-83 | None |
| A0A1F4DPJ0 | 200-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.