DPCstruct | MC55369
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 216 ± 26 aa |
| Standard deviation of domain lengths | 25.66 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14631 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453BML9 | 20-235 | NSESTSVLLDELACLVLPQVASLKSKSTTQELSHGFPTLCSSTFHSWCRVLHEENLGNFNKMIKQALKTTSQSGVAVENVMDEIVKS… |
| K3WVZ1 | 26-248 | TNAIAAKISGLALSYLQKDWSKGDAKFVYKNAHLEVFLNGYLYHSAVVLDSIQTLALDGFLELLEHNGKRVEAYPTLDKKTVSVYHR… |
| I0Z3T3 | 780-988 | None |
| A0A7S2YUP8 | 1-196 | None |
| A0A2I0XH08 | 329-546 | None |
| A0A6A3CSQ6 | 141-349 | None |
| A0A4Z2B9Z8 | 567-778 | None |
| A0A6G3MDM0 | 13-217 | None |
| A0A8B6EZD3 | 62-343 | None |
| A0A433QBD8 | 180-405 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.