DPCstruct | MC55363
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 64 ± 2 aa |
| Standard deviation of domain lengths | 2.29 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 91.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 41.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A432FAM7 | 1-63 | MNKFKKYFKNAKVIKLEYNYRSTKNILTAANKLISQNKNRDSKVLRTTRGQGNEITYYHALSE |
| A0A1D3RQ36 | 49-110 | FNFQKQYPNHLLVRLEQNYRSTGNILKASNALIACNEGRMGKALHTDDGDGDLISLYSAFNE |
| A0A519CS46 | 5-69 | None |
| A0A3S4IEM1 | 47-112 | None |
| A0A6B3W1L5 | 5-70 | None |
| A0A378AR03 | 46-107 | None |
| A0A1X2I2Q8 | 33-93 | None |
| A0A426SYJ3 | 58-118 | None |
| A0A2X3CJQ4 | 22-83 | None |
| A0A7S4L1D7 | 134-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.