DPCstruct | MC55362
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 107 ± 16 aa |
| Standard deviation of domain lengths | 15.76 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L6RK11 | 8-115 | FSHGVLFSAKVRSTLGTLVVSFSPDDASSFWLIASFSRSNFWLDAEVVSWILEAVLGGTTSLFSVVELDHWVLKFCVASSHVGFMIY… |
| A0A453BEU1 | 8-95 | LQAGLEFEDKIRKNLGSTVNHLEGTHSKEFFLVAQFSRSKIRLNLDTVGLTLQSCLGGNAARFKVSFLRNWCFKLSVASKDVGFSIYN |
| A0A287XXG8 | 7-118 | None |
| N1R4S9 | 15-145 | None |
| A0A2K2DAB0 | 32-115 | None |
| A0A2K2DP88 | 40-117 | None |
| A0A4U6U7I0 | 6-111 | None |
| A0A1Z5S7Q6 | 5-110 | None |
| A0A368QT20 | 1-118 | None |
| A0A3L6RID7 | 2-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.