DPCstruct | MC5536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 108 ± 5 aa |
| Standard deviation of domain lengths | 4.89 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.86 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | PF12161- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M7LJ63 | 1-105 | FLKVFDAQEEELEFELDDYREPIPAKYLWRNWAADNQGITGDELLEFINDDLFPTLKNLTAPKDTNPRGFVVKEAFSDAFNYMKNGT… |
| A0A166ZWI0 | 3-121 | FLKYLDDLEYERAQEAELVGKSYPFIIDEPYRWSAWAAPRTADGLFDHDTALTGADLIAFVNDELFPYLQGFRDRATGPDTIEYKIG… |
| A0A1G1YQJ0 | 37-141 | None |
| A0A482Z5H1 | 3-105 | None |
| A0A378MUI9 | 34-143 | None |
| A0A5A5TFC1 | 580-687 | None |
| A0A1T4K0Z0 | 1-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.