DPCstruct | MC55359
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 116 ± 9 aa |
| Standard deviation of domain lengths | 8.91 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0479 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N2Q1I6 | 184-291 | AWGWPALGRVLKDVPVQEGRSEVVVQISSIATLGAKDHWLQNCLFDSLASSKNQRTARKPTFRVVFPTADEVRRSLDGYASGASIHT… |
| A0A453BDE7 | 1-124 | MKKWGHMKLRSVLEECVFEKQFCKSPLIYQFSSLGSLDEKWMSEFACSLSAGKADDGSQLGIGKPLIVWPTVEDVRCSIEGYAAGSC… |
| A0A812PH40 | 870-988 | None |
| A0A7S4F9F4 | 239-356 | None |
| A0A0E9NGF0 | 236-352 | None |
| S9VC09 | 34-150 | None |
| T1KMU2 | 3-101 | None |
| A0A061RB86 | 2-120 | None |
| A0A182TNC9 | 616-736 | None |
| A0A1V9ZNZ3 | 785-898 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.