DPCstruct | MC5535
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 178 ± 29 aa |
| Standard deviation of domain lengths | 28.68 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08463 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D0S162 | 9-145 | QYYDADGKLVTESFKDYTRKTLLKEYASLDDFTRKWQDADRKEAIIHELEQQGIIWEVLAEEVGKDLDPFDMLCHVVYGQPPLTRKE… |
| A0A1G3A1K4 | 21-188 | DADPHSFTEQRTFTDGRIVVAGGRTFRRPQKRADWANPEKRSDIIARLAERGIDFGELAAAAVQPGADPLDLLCHVAFNAPLRTRRE… |
| A0A378MTI9 | 1-155 | None |
| A0A7C4BJB0 | 1-179 | None |
| A0A7C4N224 | 72-265 | None |
| A0A357HX71 | 242-433 | None |
| A0A7Z9WFT1 | 91-239 | None |
| A0A402A052 | 884-1073 | None |
| A0A0K1S520 | 518-689 | None |
| A0A509BRD5 | 30-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.