DPCstruct | MC55349
Metacluster Properties and Pfam Annotations
| Number of structural domains | 212 |
|---|---|
| Mean domain length (aa) | 329 ± 78 aa |
| Standard deviation of domain lengths | 77.66 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 80.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.57 |
| Pfam Score | 99.56 |
| Assigned Pfam label(s) | PF04889- PF05183 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6B4L5 | 29-367 | LKKGIASWLDNLGNKLRVRVPRSTFAFGIADFQRVLQLGEIFLSFYRVLPDAQLPCLHNMDVLIARYPMHRPSNVQKVRAVYYPELA… |
| A0A1Z5JKS3 | 524-764 | KHMATNVLEASQIPKTVIDKYVKNATSTNGLEHAFVLGASDPTNAIPPGHVFLSGFTHDLPDHILVTRFPCTESSDLLKLPLVKTKP… |
| A0A6D2HEF4 | 6-352 | None |
| A0A7M5UQ26 | 308-745 | None |
| A0A820AG74 | 304-599 | None |
| A0A6V7PSC8 | 29-450 | None |
| A0A813V344 | 205-564 | None |
| A0A146HU95 | 311-680 | None |
| A0A843FR74 | 2-465 | None |
| A0A843GFR5 | 39-381 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.