DPCstruct | MC55347
Metacluster Properties and Pfam Annotations
| Number of structural domains | 117 |
|---|---|
| Mean domain length (aa) | 358 ± 72 aa |
| Standard deviation of domain lengths | 71.91 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 14.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M7LY58 | 25-372 | PETSPGINGLIATCNKHDRFKLLEDEGVLPGNMNNPIHPLFSWFDSKGPMHQMLQLASHFITHDALLVFFVPLLYGHELTSVNKPTN… |
| A0A6A6AZA0 | 14-381 | FDELRAGGYIDLDQPFRDELSASEIHPLFGPSQWINIDQQSLDLLEPTFKLASKLLAHPRILLFWHALMNNRRFIRSRRLAGMFGRK… |
| A0A6A5WWR4 | 69-378 | None |
| A0A4S9JDL7 | 684-1089 | None |
| C4JMT9 | 29-404 | None |
| A0A146HNS0 | 24-282 | None |
| A0A3D8S5L4 | 26-333 | None |
| Q2GWM3 | 111-428 | None |
| A0A553IF01 | 115-503 | None |
| A0A1A6A997 | 2-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.