DPCstruct | MC55346
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 326 ± 73 aa |
| Standard deviation of domain lengths | 73.45 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 69.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 22.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6AZ21 | 1-289 | METTSIWLGNSSRPVSTLCDGWPRAPGSGLSYVSSMVTRKVYNPPSYTGPTPTCRYNYHGCELMVLSYLEEYSRVESISTATRPRSP… |
| A0A2G5HY34 | 81-412 | ETTTVYYGGTAMSQVTYYENATTLCDGHPRVLYSPAIPLSTEWRTTVEPTTATSVYTDTVGRVYSAPSPSCTIRPQDCDPLWSDYSK… |
| A0A2T2NE17 | 3-432 | None |
| A0A178EKD5 | 339-550 | None |
| A0A6A5ZNB0 | 219-532 | None |
| A0A2P8A6C4 | 21-417 | None |
| A0A6G1GCW0 | 25-364 | None |
| A0A6A6CEI5 | 269-668 | None |
| A0A6A6B9P0 | 1-416 | None |
| A0A1V8UZM7 | 52-345 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.