DPCstruct | MC5534
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 133 ± 12 aa |
| Standard deviation of domain lengths | 12.17 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842WT06 | 5-145 | GYWLNPRTGEYIEVNKHEKWISNKKNARHIGLSKRAYEEIKQLNPSEDIDEIRIIAIIDGLVRIRDYQSKVAIQFYAGRGQTRKVLW… |
| A0A1G3A052 | 3-125 | KGKGWWISPSGEIVEIFEHYMFVQERPELFGFPRADTLKWKSTDRDKILAKAIGRGWIRVRNEEYETWELTPKAVSRIAKHLRITGA… |
| A0A7C3YVP1 | 9-107 | None |
| A0A1V6KDG6 | 1-129 | None |
| A0A1H9FN78 | 5-133 | None |
| A0A2V5VGY4 | 124-265 | None |
| A0A2K3J1U3 | 6-150 | None |
| A0A1W9M3A6 | 1-139 | None |
| A0A3P3XPK7 | 1-130 | None |
| A0A2N9NTK7 | 40-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.