DPCstruct | MC55331
Metacluster Properties and Pfam Annotations
| Number of structural domains | 205 |
|---|---|
| Mean domain length (aa) | 140 ± 25 aa |
| Standard deviation of domain lengths | 25.33 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 11.31 |
| Pfam Score | 71.43 |
| Assigned Pfam label(s) | CL0193- PF16107 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A524PKM1 | 18-139 | PLVLLASLLAPGMVSAEGEEATITNRLITSGVAVTSVSTSGSKVTVQYEQAVAEMDSVVTVLQKVGTILSVVSEEMPSVQAVVVVQY… |
| A0A3D5SP25 | 21-156 | TKYKSQLDALATAGQSTYHFVPYAPPSLIVFRNQIVLQLTLRNPNTFDKEATSIYKRAARSFDLFLAPQLKSILERIPDDAELGGLD… |
| A0A7W0NRN8 | 144-305 | None |
| A0A7G8T6Q0 | 1-164 | None |
| A0A343TG62 | 4-116 | None |
| A0A7W7H2B3 | 94-254 | None |
| A0A0C2ZQ51 | 253-383 | None |
| A0A2M8PV53 | 54-193 | None |
| A0A351I7G4 | 12-148 | None |
| A0A2E0UNR5 | 39-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.