DPCstruct | MC5533
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 137 ± 14 aa |
| Standard deviation of domain lengths | 13.85 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S3R455 | 2-116 | SSVAYLASYLCRAKFLPAALVTTIIHSLVDWCYAYCKLRDFDMNPRAHQVFYSGCQAIMYILCFRFRSSMDIRRLKLQLLNIPMDKI… |
| A0A1Y1M974 | 74-214 | AEAFLNFLWRKVCNPNVPSIHRHSAVSYMASLVARASFVPLYMLKGTLQEMANWIFAYMATQDGHGCINTDIRIHVVFYSVCQALFY… |
| A0A1I9G4Q1 | 69-214 | None |
| A0A821UND5 | 313-428 | None |
| H2NQM3 | 1-147 | None |
| H2NRY3 | 115-256 | None |
| A0A6A5DCG3 | 112-256 | None |
| A0A2A4JRA4 | 147-294 | None |
| A0A834XN33 | 342-482 | None |
| A0A7R8WYV9 | 358-498 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.