DPCstruct | MC55324
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 115 ± 20 aa |
| Standard deviation of domain lengths | 19.99 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 23.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A136KJE2 | 1-93 | MSGLSYLQIRTPKEDETPIEATTQIFSSLLPSSTKWYKVILKKQVGYSFEIYLLGQRIYFYIATPTAKETFVKSLVASSFPSSAIVK… |
| A0A0G1MNM6 | 2-85 | IAERVILSIRVPKEIEPGPGPIVAEQIFSAIHSIQDDFPWYKRLFGLRGSRISFEISHTKRHIRFLVNCERRYKNLIEGQIYAH |
| A0A2M7H5F1 | 16-145 | None |
| A0A1F7I7F4 | 1-94 | None |
| A0A6L4ZP55 | 4-127 | None |
| A0A0G1UPG1 | 1-99 | None |
| A0A644T8G6 | 5-141 | None |
| A0A0G0FK53 | 17-128 | None |
| A0A7C0ZSR0 | 8-105 | None |
| A0A3D0UX25 | 3-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.