DPCstruct | MC5532
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 78 ± 6 aa |
| Standard deviation of domain lengths | 6.20 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 62.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A218X3K4 | 205-286 | VCPLDFPNITKVAAECEGPINNRTACCKAMDSYTSWLQRQSFLTNLQALNCAAMLGMKLQKANVSKNLYNLCHVNLRDFSIQ |
| A0A0S3QZK9 | 2-88 | QVARGCGDGISNKTACCNAMESYVSHLQKQSLIMNLQALDCAKTLAMKLKRSKITADIYGLCHITLKDFFLQVGNQGKVSLMGKEGE |
| A0A6A3CV68 | 256-337 | None |
| A0A484LYS1 | 22-94 | None |
| A0A1E5UVL6 | 126-198 | None |
| A0A2N9I6Y3 | 259-335 | None |
| M1A235 | 1-79 | None |
| I3T0X3 | 62-135 | None |
| V4U4G0 | 287-379 | None |
| U7E2L5 | 296-369 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.