DPCstruct | MC55319
Metacluster Properties and Pfam Annotations
| Number of structural domains | 85 |
|---|---|
| Mean domain length (aa) | 143 ± 34 aa |
| Standard deviation of domain lengths | 34.41 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 87.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 24.25 |
| Pfam Score | 82.86 |
| Assigned Pfam label(s) | PF07336- PF11706 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G2JQ19 | 15-148 | NGLTGAHPAGAEALRHLCAAREALTAAVDGSPQQAAPLVDAVLAHGRIRARLTAEGPTEEPEFADPSWGPAWLAARSYLDLLSRAPE… |
| A0A1G6I9R2 | 13-128 | RDALWRLVEARVAGERPAPDDLAVLNDAAAHPPLTPRLTADGTWAWGPGGTGTGLLSTVARDAVDLFTGAYAHRIRVCGAHDCRLLF… |
| G4HAL3 | 1-175 | None |
| A0A5N6BL25 | 6-114 | None |
| A0A7L7MDS0 | 9-108 | None |
| A0A6J4JS32 | 13-119 | None |
| A0A2V7S0E8 | 141-313 | None |
| A0A2A6FRD0 | 37-210 | None |
| A0A5D0QFQ7 | 70-177 | None |
| A0A356UB80 | 119-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.