DPCstruct | MC55314
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 76 ± 12 aa |
| Standard deviation of domain lengths | 12.35 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 95.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 24.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V6HFG7 | 218-281 | IKKGYDEFEKLADLQFALMDDHRLLTPTVSLTTYSQGTRVVVNHGSAPYVFEGVDVPAGDWRRV |
| A0A7X7BJ07 | 4-64 | YQFIYNALEKVLGEEIIYREVLAKGIVRVTYSNDVKIIINYTNTDYEYEGEIVSAGNYLVK |
| A0A2S8PDD9 | 25-93 | None |
| A5KWA4 | 263-356 | None |
| A0A5E6MX32 | 368-446 | None |
| A0A2R7Q4B7 | 519-609 | None |
| A0A7V4N2H6 | 133-199 | None |
| A0A1V5G556 | 162-245 | None |
| V5H4X3 | 9-103 | None |
| A0A7U8WQ11 | 5-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.