DPCstruct | MC5531
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 73 ± 2 aa |
| Standard deviation of domain lengths | 2.31 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 78.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 53.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453NQR4 | 57-129 | MGFLRNPKAFLMVIKAVIESTDYRFILFSSGYQPLDSAIRSFASLAVESSVEAPALSNDSTLLFNNRLFCLSG |
| A0A0S3QW80 | 1-72 | MGFLKDPYAFICIFQTVLSSTNYRFILFTAGYEPLESIVRSISTTEASFELKNCSDDCVPLCNGRLLCFFGS |
| A0A2U1LH84 | 44-115 | None |
| A0A287TYZ2 | 127-199 | None |
| A0A2U1MWK3 | 1-75 | None |
| A0A484N5F3 | 1-75 | None |
| K3YU09 | 227-298 | None |
| M0XHF6 | 127-199 | None |
| A0A287TZ55 | 56-132 | None |
| A0A453NRH1 | 338-410 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.