DPCstruct | MC55300
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 393 ± 84 aa |
| Standard deviation of domain lengths | 84.29 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 88.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K0DUD9 | 287-611 | RAVTTVLDRYGIRTPEERAAVEQVHNVITEHLAPLVTYGTVKILEAARAAVAEHPDTRVVFVGRDGHSPALAAQQLDPEFFRRHCTE… |
| T0IY00 | 50-475 | PSEIVMFGDNERSDFQIPADLGLQAIHVMKPSNLLKAIPRFADLIPDARSASPGEQFVFGAIAAENFSSVSFPQFSADDMFRSAQQI… |
| A0A7U3C101 | 135-567 | None |
| A0A0G0LH64 | 38-333 | None |
| A0A512IVS1 | 413-882 | None |
| A0A843DZ62 | 50-395 | None |
| A0A6N0WUT5 | 29-355 | None |
| A0A7C1G1D9 | 5-481 | None |
| A0A810M010 | 22-355 | None |
| A0A830WB09 | 81-346 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.