DPCstruct | MC553
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 111 ± 11 aa |
| Standard deviation of domain lengths | 11.23 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 71.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L8M6T4 | 87-182 | AQNGVLERESVQVVNDNPEYTPVKRRTKGKGTGFIEERLVKRGDKQYKQYWFHWQKSEPGKRRVLARSKYIPKRLVAKIIENNNQKL… |
| A0A235IEB6 | 21-135 | HPPPVSELLLGGIDNSPSKNNPSNDVKQSEITPSKDSSSKTRRHKGLGSGSIQWKTITLHGKDYPQAWYHYEFWKDGDRLVKKCKYI… |
| K9RH74 | 514-627 | None |
| A0A1Z4I1W1 | 93-184 | None |
| A0A3S1IWQ2 | 398-489 | None |
| A0A2T1BXU0 | 76-177 | None |
| A0A218QVG0 | 812-930 | None |
| A0A2H2XW89 | 74-197 | None |
| I4GXD2 | 3-129 | None |
| A0A1Z4LU62 | 418-542 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.