DPCstruct | MC55298
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 111 ± 6 aa |
| Standard deviation of domain lengths | 5.81 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T0LBG5 | 1-117 | MSSLWAFEMNERNTPGIGRVLARYGLDAVPEAHCYLKYGNCRLDVTRTVSVQAEPVRTWLWEENIRPDQIGEYKVSLHQAYIRSWAA… |
| A0A2G6F752 | 49-158 | IELILGIYKMNESNTPKIGTELTENAIGFIPQAHCYLKINGERIDFTSKESEFKKIEKDIIKEQKIEPEQVIEFKVNYHKKFIKSWL… |
| A0A448ERZ0 | 1-98 | None |
| A0A017SXU0 | 26-137 | None |
| U2HUN4 | 289-402 | None |
| A0A1I3IUP7 | 76-195 | None |
| A0A7I8EG04 | 5-116 | None |
| A0A843TEZ8 | 46-150 | None |
| A0A2D0N5G2 | 339-448 | None |
| A0A2P6UVX0 | 67-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.