DPCstruct | MC5529
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 94 ± 13 aa |
| Standard deviation of domain lengths | 13.01 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 50.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0479 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821I0Q0 | 2-91 | FNIGLLMDAGARVHVMLYKEMSFALALNSLYTETKLVSKSTKVIRHPGHNTKDCLVSWFHHEKMVVIHQKTAFIGGIDLCYGRWDDE… |
| A0A7N0VHI7 | 93-180 | LEAKAKQGVQIYILLYKEVSIALKINSHYSKRKLLEIHENVKVVRYPDHLSSGVYLWSHHEKLVIVDYNVCYMGGLDLCFGRYDTIEH |
| A0A556TYL6 | 151-259 | None |
| A0A817QRY2 | 138-256 | None |
| A0A819ZBF8 | 142-251 | None |
| A0A438NJV0 | 126-234 | None |
| A0A6I9YCC0 | 408-492 | None |
| A0A438DX11 | 189-298 | None |
| A0A6J3BPX7 | 2-82 | None |
| A0A1E3JM94 | 579-667 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.