DPCstruct | MC55279
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 258 ± 43 aa |
| Standard deviation of domain lengths | 42.69 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12166 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6MTE8 | 12-246 | APVECQSKGWHKSLTPAADVEREIHESQKAGFFEEINFPYPIVSVIGGGKREIDLYAYYFGADLAVFFLVAMFYQSILKNKSEFLEV… |
| A0A3Q3JQ24 | 4-247 | EKLREQLYKGKAFLIKFMEIYLPMRQFFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGQKNTAADITSSLSEDRVPGAFL… |
| T1KNZ3 | 30-269 | None |
| A0A821IUN5 | 2-206 | None |
| A0A3P7DXQ6 | 2-203 | None |
| A4I9U0 | 1166-1411 | None |
| A0A7G2C012 | 365-665 | None |
| A0A177AQG0 | 40-343 | None |
| A0A5S6P970 | 974-1216 | None |
| A0A0B2VML1 | 313-567 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.