DPCstruct | MC55268
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 272 ± 29 aa |
| Standard deviation of domain lengths | 29.40 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 16.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M6ZVN5 | 78-342 | TYEDMGLWLCKDFIRVERNNLIMEEIFKGQYWYRNMLIFANCQQFDLTANRNNIRTDQEEYYLAIMGIKKFIEEIKSNPATISYFKT… |
| A0A3S7UU73 | 2-288 | CRDFIPIVRKNELLEKALEEASGNGLGYDLGNLRNWQIFVNHQRFLPTANRGDISNFSEHEPRLLNHLVEWMREKLKDESFNEWIGR… |
| A0YSE8 | 54-365 | None |
| A0A7M1KKW1 | 231-539 | None |
| A0A7X4FJY8 | 217-447 | None |
| A0A0R2BKJ1 | 134-379 | None |
| A0A3E0BIW8 | 24-338 | None |
| J7ZY85 | 492-740 | None |
| A0A7C3JYL1 | 1-251 | None |
| A0A3D4QNU2 | 16-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.