DPCstruct | MC55266
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 105 ± 7 aa |
| Standard deviation of domain lengths | 7.44 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A085WW11 | 4-112 | QPAPPSSAYVLIADQYHLLVYNRDLQERRIFPHPVLQYFLGARVREGLPPPVASFSTLPEAEAWFKSQVSPPPQAVISIAGELYLTV… |
| A0A1H7M439 | 149-250 | KGAAEPPSPARILIGDEYHQVWYTREDGTRGLYRDPAIEPVMEAMVVQGFPERMPAFGTRAEADAWLMRHPANPYAFVSIAGERYFA… |
| Q08RD5 | 166-268 | None |
| A0A4Q6ABX9 | 18-123 | None |
| E3FEU5 | 78-183 | None |
| A0A3A8IIL7 | 68-176 | None |
| A0A250IY99 | 17-118 | None |
| A0A084T0L3 | 45-144 | None |
| A0A0G3A424 | 1-108 | None |
| A0A0G2ZVM6 | 1-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.