DPCstruct | MC55263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 282 ± 27 aa |
| Standard deviation of domain lengths | 27.31 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2D4Y4 | 139-406 | TEESGGEETGGDECEPFDHDPRRSLIETNLEALAGVSMAEVLDRAALSADLIGDPEFTHTRLVDSFTTSEDAALPGGSHCDDLLVKG… |
| W4LDS6 | 371-624 | EADDDEGPPIVDINPRRSLIETNTTVTEGFNLRHILQRIAENSGLTSNPVRHYQQLIDAYNSRVVTPGAQACTGTLNGFPLECDRLE… |
| A0A1H6LR67 | 1-312 | None |
| A0A5E6NKI5 | 1-286 | None |
| A0A5E6N928 | 1-354 | None |
| A0A5E5QHL8 | 1-284 | None |
| A0A2W5P332 | 15-296 | None |
| A0A511TH40 | 5-296 | None |
| A0A1Q3HN31 | 2-263 | None |
| A0A2A5HR66 | 1-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.