DPCstruct | MC55256
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 218 ± 13 aa |
| Standard deviation of domain lengths | 12.93 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J5BKP2 | 6-210 | YPEEEVKKARRLVSSLIRSAEEVEEKIEEAAEKGELSELVLMVIWNRLDLARRDDEKDAVRSLDLLYRRIETEILKREATPAMRLLN… |
| A0A2V0P5D4 | 89-316 | GEQRRKGAILLELLRAGQQLESKLAQFRHEIDDVLVALMRRRLETAIDAGEEPAALAAYDALYGRLCRERARAASSPAARLIDDALA… |
| A9T5M2 | 41-250 | None |
| I0Z753 | 1-221 | None |
| A0A438F4K3 | 130-330 | None |
| A0A2P2KYG1 | 7-229 | None |
| A0A2Z7AGX7 | 286-488 | None |
| A0A2P6U572 | 184-408 | None |
| A0A383VCY0 | 169-410 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.