DPCstruct | MC5525
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 67 ± 7 aa |
| Standard deviation of domain lengths | 7.35 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 56.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182Y322 | 2-62 | EGPVTKSIRLTSALILRNLVVYTNSAKRSLRMYEAHLAGVALSNVESSRTVAQLLFEMNDT |
| A0A821G3N5 | 18-79 | NKEGPLTKSIRLTAALILRNIARHSSIGKQNLRQYEQIIANLALESTEASQILSSCLFELCN |
| A0A821XTG3 | 206-271 | None |
| S4P2H8 | 121-186 | None |
| A0A6A4W8Y6 | 746-808 | None |
| A0A0K8RBQ1 | 18-78 | None |
| A0A820XLI9 | 343-404 | None |
| F6NXG0 | 1490-1571 | None |
| A0A0N1IC16 | 667-729 | None |
| T1GBI2 | 95-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.