DPCstruct | MC55248
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 83 ± 7 aa |
| Standard deviation of domain lengths | 6.50 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 75.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00032 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C2DUV5 | 23-100 | MGHNYYGEPAWPNDLLYMFPVVITGTIALITGLAVLDPTMVGEPANPFATPLEILPEWFLYPAFQILRIVPNKLLGFI |
| A0A059CC06 | 1-86 | MGHNYYGEPAWPNDLLYIFLVVILGTIVCNVGLAVLEPSMIGEPTDPFATPLEILPEWYLFPIFQILHTVPNKLLGTDPHQPLMMI |
| D8TEA0 | 70-165 | None |
| A0A251TH80 | 41-124 | None |
| A0A5D2PHQ0 | 1-78 | None |
| A0A835P7R8 | 1-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.