DPCstruct | MC55241
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 244 ± 32 aa |
| Standard deviation of domain lengths | 32.37 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 61.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 38.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A814HWR2 | 210-511 | QDDNPEVITKKSDQTVQYVQEVSIRYLQPPSPIPHGEILIQHEKPVVPPPAPPIVIRQQPPMPETPAPLVIREAPPKPIQTQERKII… |
| A0A818V472 | 1-258 | MVPDPKIIRRSSPERGVTYAQRVVIQCLQPPPLPPPEPLIIKEVRPAQPPPPEPLVICERPSGGTTPPPLILRERPPIPPPRISGGT… |
| A0A3M7S3N0 | 17-269 | None |
| A0A819HC69 | 202-389 | None |
| A0A815PV96 | 146-401 | None |
| A0A819ZXD4 | 1-224 | None |
| A0A822CJJ8 | 1-218 | None |
| A0A816KWG5 | 134-381 | None |
| A0A816GPR3 | 81-362 | None |
| A0A818ZF59 | 1-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.