DPCstruct | MC5524
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 115 ± 11 aa |
| Standard deviation of domain lengths | 11.00 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 94.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 67.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03747 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820EX66 | 80-203 | GVAGNGALMRLTPVSLFFHANPEAAVEFSGISGRITHGDKKAYDACRYYGALICAALKDYKKSDILDKDFYEKHKHWFGNTPLCDEI… |
| A0A821FIE5 | 1-101 | MAVHYSGISGQITHGDDKVYDACRYYGALIVAAMSGAQKNELTSKTFYDDHLEWFGDRILHSEIMAIAQGSYQRPGGYQDGIRGKGY… |
| A0A814IZX0 | 465-593 | None |
| A0A814S7I9 | 1-115 | None |
| A0A821WGA7 | 60-183 | None |
| A0A821VZ58 | 59-182 | None |
| A0A822AF10 | 1-99 | None |
| A0A821G2P1 | 1-99 | None |
| A0A818Z8R6 | 1-115 | None |
| A0A814UUH9 | 536-658 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.