DPCstruct | MC5523
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 122 ± 14 aa |
| Standard deviation of domain lengths | 13.89 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 37.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C3XW43 | 295-403 | RGELLVLTGGLALALMSVLGVTSIPSVQNAMTWREFVFVQSKLGFLCLFAGTVHCIVYGSTGFDKSYLYIWYTPPPFLLAMLLPCLV… |
| A0A821DHJ4 | 36-143 | KGELASLMGILTLLSMSLLALASIPALANLLNWREWRFIQSKLGTFTLLCAIGHVFAMATPRWIELGFTKSLKSVGFLCVFFPLITI… |
| A0A822F1S7 | 54-202 | None |
| A0A6P8PXS3 | 108-239 | None |
| A0A6G0HHG7 | 31-147 | None |
| A0A1S3NIJ2 | 680-797 | None |
| A0A4Z2EB41 | 2-114 | None |
| A0A7D9L8G6 | 67-212 | None |
| A0A817L7H0 | 503-601 | None |
| R7TH89 | 4-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.