DPCstruct | MC55224
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 113 ± 9 aa |
| Standard deviation of domain lengths | 8.75 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 39.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A561TYX3 | 326-444 | PLWERKTGGRTVRLLEDAVASGVSLRDVITDSRRPEDGLMREEMEDSRVLAVLADLAPAERAVAMAYGTQRMTWCQAAALGGAVDPD… |
| A0A3N4RV65 | 1-127 | MVPLWRRRTYGNRRVLLLEKPSPSGTLRDLLADRALPDDHVLDQIPGDRRLVILLDRLAPPERAVVLAFGHPGVVTWADAAGHTGSA… |
| A0A6G2RNC2 | 1-118 | None |
| A0A7K2NWL4 | 95-197 | None |
| A0A1E7NEA2 | 170-287 | None |
| A0A5J6EXI9 | 155-262 | None |
| D7C522 | 1-107 | None |
| A0A1U9QSR5 | 227-352 | None |
| A0A120CSU1 | 107-228 | None |
| A0A4Y3RMX5 | 192-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.