DPCstruct | MC55219
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 111 ± 11 aa |
| Standard deviation of domain lengths | 10.68 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 94.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 28.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R1FUP7 | 1-123 | MEGQGALNHPRYSGVTLGLLHGTRPDAMVLCHDLRRTALGLLPQVALPSLRRAIEINEEAARWAEPDRAPRVIGLSVVTAGLGDDEA… |
| A0A831KZ64 | 1-87 | MQHAPARKDYDGFPGYPVHALPRQIQAVDVISDRPVVAITVNHENLSVSETMVACRTIRSQTGLPAMDVLREGAGALADVVLAHAKQ |
| A0A7W0ZEH5 | 47-167 | None |
| A0A7Z9SCY9 | 6-120 | None |
| A0A2T2WR67 | 295-394 | None |
| A0A6L5FZZ3 | 1-99 | None |
| A0A7K1ZLA7 | 31-144 | None |
| A0A7J4IDT3 | 68-184 | None |
| A0A4V1SCZ4 | 941-1057 | None |
| A0A7C7M2I3 | 62-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.