DPCstruct | MC55217
Metacluster Properties and Pfam Annotations
| Number of structural domains | 277 |
|---|---|
| Mean domain length (aa) | 145 ± 33 aa |
| Standard deviation of domain lengths | 32.89 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 87.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 30.82 |
| Pfam Score | 99.10 |
| Assigned Pfam label(s) | CL0125- PF01625- CL0366 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C8YWY7 | 1-82 | SYETLLDVFWDKHDPTTLNRQGNDVGTQYRSGIYYYTPEQEKAAIESRDRRQKLLNRKIVTEILPAKKFYRAEEYHQQYLAK |
| M4BRQ0 | 7-127 | HASQPQNVAMFAAGCDWGVQLAPTYAQVCTGKTKHAEAIKIVFDDRQVSYDALLSKFWSIYDPTSLNRQNTEQGTQYRSGVCYHTEE… |
| A0A6G3VAK5 | 4-97 | None |
| A0A376E940 | 47-155 | None |
| A0A0K9QI13 | 143-307 | None |
| A0A834MZT9 | 27-181 | None |
| A0A1Q9CDL2 | 111-323 | None |
| A0A7M5UNR8 | 1-90 | None |
| K8EJ57 | 5-127 | None |
| A0A7S2UIN2 | 70-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.