DPCstruct | MC55211
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 298 ± 26 aa |
| Standard deviation of domain lengths | 26.40 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11707 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M4BA55 | 19-311 | DDAILSFARSLLLYPPATNTSPPIPLSQDDASSLSHQFLAIHPQGELFLRVWPENHGAGSRYEKRDSFAIFLHVVTHLLQVQQQLDA… |
| A0A6L2PSZ6 | 2-260 | KWGLMEHKNKQKKRERNLEAVKEFVNLCKSPDTDIVILQYLEAEGGAQELIGLLQSDNKKNMAAVVPVFSALQYIVMKTLREAQEYR… |
| A0A7J7KTZ9 | 11-278 | None |
| A0A1S3IKB6 | 1-324 | None |
| D4A7S4 | 32-357 | None |
| D7KV35 | 20-305 | None |
| A0A0G2G7I2 | 32-367 | None |
| A0A1R3KHX6 | 7-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.