DPCstruct | MC5521
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 213 ± 16 aa |
| Standard deviation of domain lengths | 16.18 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 17.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832CK77 | 2-203 | ASSPRERALKRAKLMKRLVEQLDAVRALKLFNTADALRAMSELSLSGDPWSELRSVLTEIAKIPQREPFFAKIRRFDKVSNTLLWTS… |
| A0A524CKG7 | 28-263 | RQKNPPLSEDSPPTQFIQYMLTAIGFYDYLINRPFDLIFQDKMYMQYDAEIIDPLLTYNDAFKKTHEENEVDSLLNSLRETAIKRAE… |
| A0A842R5M2 | 69-292 | None |
| A0A497RDH2 | 10-214 | None |
| A0A151F1X9 | 47-253 | None |
| A0A7J3BCX3 | 13-204 | None |
| K6U9P0 | 190-392 | None |
| A0A850MIW1 | 160-386 | None |
| A0A7C4ZP33 | 2-187 | None |
| A0A524F391 | 5-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.