DPCstruct | MC55209
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 132 ± 14 aa |
| Standard deviation of domain lengths | 13.60 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 22.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M7LKI1 | 28-157 | LTEYWDDPLPLMVSDPRTRNYMGKEVHIFDPDSSDKWNIINEQLASADYYIMSSNRGWGSIGEASERYPTTSLFYKKMFEGTNGFML… |
| A0A0K8PB29 | 625-756 | NQVRWSDNEEKKKMLLDTLDKSDYLILPSQRGMWSVCRIPLTYPMTIAYYEALFDGNLGFELVAAFQRPFRIGPLVISDLAGTVSWN… |
| A0A136KUN5 | 1-147 | None |
| A0A1F5ZKX7 | 366-511 | None |
| A0A3L7WSN9 | 453-585 | None |
| A0A0G0V5C0 | 2-134 | None |
| A0A7C4KFU1 | 12-157 | None |
| A0A2U2S9Q5 | 174-303 | None |
| A0A538SG51 | 555-674 | None |
| A0A1F7HVP8 | 132-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.