DPCstruct | MC55202
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 89 ± 14 aa |
| Standard deviation of domain lengths | 14.04 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 32.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E2ELS7 | 5-90 | LLILLCLPIFIYSQNSISGVINSNQIWTIAGSPYIVTGSVLVNSGVTLVIEAGVIVKFDFDKFLKIDGELIAQGTSSNKITFTSIK |
| A0A800EA85 | 484-572 | VDCTTLSGPISKNTFLSSSKSPYLLNQTLKIERGATITIEKGSEILLGAGVDIVMHGNLIAKGTSENPVVFRPMQKAKEWGEVLFDG… |
| A0A1F8F4F1 | 2-96 | None |
| A0A044U109 | 12-72 | None |
| A0A2A6CGQ7 | 33-110 | None |
| A0A1F6XII2 | 13-100 | None |
| A0A497P7A0 | 35-116 | None |
| A0A1M3IH53 | 1-94 | None |
| A0A7C3SS99 | 196-275 | None |
| A0A497PPH9 | 110-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.